Scaffold Ga0315273_10041325

Overview

Basic Information

• Taxon OID: 3300032516
• Scaffold ID: Ga0315273_10041325
• Source Dataset Name: Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6197
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.5119
  • Long. (^o): -110.3577
  • Depth (m): 80

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076701	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315273_100413253	F076701	AGGAGG	MVYRPPMIKQGDGSRCQWTNCNCASHAMAVMRHRLGMDPHNEHGWPSSPAEIRNRLGACGGTNLPENDLAVQHLYGVNMDVRYNVPMATFRSLIISGRGAVVPIWYGIIAPTKYDASPGFTGGHGIYVNERRASDGAYYVYDPLADGRRKGIPKGPQWWPASLLQRAAETYPGTRSGCIHASFTRDTE